PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01077.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 281aa    MW: 32034.9 Da    PI: 8.0246
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01077.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.42e-5171311128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lp+GfrFhPtdeelv++yL++k++++++++  vi+e+d+yk++Pw+Lp k   +ekewyfFs+rd+ky++g+r+nra+ sgyWkat
  Rsa1.0_01077.1_g00004.1   7 LPAGFRFHPTDEELVKFYLCRKCASEQISA-PVIAEIDLYKFNPWELPDKSLYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKAT 91 
                              799*************************99.89***************6666789******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk++ +   ++ g+kk Lvfy g+apkg kt+W+mheyrl
  Rsa1.0_01077.1_g00004.1  92 GADKPIGK--PKTLGIKKALVFYAGKAPKGIKTNWIMHEYRL 131
                              ******98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.2E-603159IPR003441NAC domain
PROSITE profilePS5100559.2437159IPR003441NAC domain
PfamPF023653.7E-278131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MKAELNLPAG FRFHPTDEEL VKFYLCRKCA SEQISAPVIA EIDLYKFNPW ELPDKSLYGE  60
KEWYFFSPRD RKYPNGSRPN RAAGSGYWKA TGADKPIGKP KTLGIKKALV FYAGKAPKGI  120
KTNWIMHEYR LANVDRSASV HKKNNLRLDD WVLCRIYNKK GTMEKYYPTD EKPRTITDHS  180
SSPFDTSVSS YPTLQEDDSS SSGGRVVSPD AREVQSEPKW GELENAFDTS MFGGGSMDLL  240
QQSEAAFVPQ FLYQPSTDYF NSWQDTQEQK PFLNWSFGPQ G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-84216510174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2458830.0AY245883.1 Brassica napus NAC-domain protein 5-8 (NAC5-8) mRNA, complete cds.
GenBankKF7382750.0KF738275.1 Brassica napus NAC transcription factor 81 (NAC81.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002873383.11e-179hypothetical protein ARALYDRAFT_908859
SwissprotQ9C5981e-179NAC81_ARATH; Protein ATAF2
TrEMBLA0A087G5T11e-179A0A087G5T1_ARAAL; Uncharacterized protein
TrEMBLD7M2081e-179D7M208_ARALL; Putative uncharacterized protein
STRINGscaffold_600916.11e-178(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.11e-170NAC family protein